PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000727.1_g00002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family ZF-HD
Protein Properties Length: 94aa    MW: 10012 Da    PI: 7.8868
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000727.1_g00002.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer106.91.2e-332683360
              ZF-HD_dimer  3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60
                             ++rY eC+kNhAas+Gg+avDGC+Efmps +e + aaal+CaACgCHRnFHRreve+e
  Itr_sc000727.1_g00002.1 26 SIRYGECQKNHAASVGGYAVDGCREFMPSGEEGSGAAALTCAACGCHRNFHRREVETE 83
                             689**************************555589*******************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257742.0E-162790IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047703.9E-302780IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015662.5E-272880IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152326.4342979IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Sequence ? help Back to Top
Protein Sequence    Length: 94 aa     Download sequence    Send to blast
MKRHKVVVKR EQSSQSSANS SFAVSSIRYG ECQKNHAASV GGYAVDGCRE FMPSGEEGSG  60
AAALTCAACG CHRNFHRREV ETEVLNDVSS SNAS
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007032530.15e-42Mini zinc finger 2 isoform 1
RefseqXP_007032531.14e-42Mini zinc finger 2 isoform 2, partial
SwissprotQ9LJW52e-34MIF2_ARATH; Mini zinc finger protein 2
TrEMBLA0A061EEU85e-42A0A061EEU8_THECC; Mini zinc finger 2 isoform 1
TrEMBLA0A061EGD25e-42A0A061EGD2_THECC; Mini zinc finger 2 isoform 2 (Fragment)
STRINGVIT_14s0108g00810.t016e-41(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11052486
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28917.11e-23mini zinc finger 2